Serratia plymuthica S13: M621_03235 Help Entry M621_03235        CDS       T02716                                  Symbol ilvH Name (GenBank) acetolactate synthase   KO K01653   acetolactate synthase I/III small subunit [EC:2.2.1.6] Organism sry  Serratia plymuthica S13 Pathway sry00290   Valine, leucine and isoleucine biosynthesis sry00650   Butanoate metabolism sry00660   C5-Branched dibasic acid metabolism sry00770   Pantothenate and CoA biosynthesis sry01100   Metabolic pathways sry01110   Biosynthesis of secondary metabolites sry01210   2-Oxocarboxylic acid metabolism sry01230   Biosynthesis of amino acids Module sry_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine sry_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:sry00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     M621_03235 (ilvH)    00660 C5-Branched dibasic acid metabolism     M621_03235 (ilvH)   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     M621_03235 (ilvH)   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     M621_03235 (ilvH) Enzymes [BR:sry01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      M621_03235 (ilvH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ALS_ss_C ACT ACT_5 ACT_4 ACT_8 UvrB_inter Motif Other DBs NCBI-ProteinID:  AGP42973 UniProt:  S4YJJ2 LinkDB All DBs Position 705260..705751 Genome browser AA seq 163 aa AA seqDB search MRRILSVLLENESGALSRVVGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDEKVLEQI EKQLHKLVDVLRVSELVQGAHVEREIMLVKLQASGYGREEVKRCADIFRGQIVDVTATLY TVQLAGTSDKLDAFLNAVREVAEIVEVARSGVVGVSRGDKIMR NT seq 492 nt NT seq  +upstreamnt  +downstreamnt atgcgacgtattttatctgtattgctggaaaacgaatccggcgcgttgtcgcgtgtggtg gggttgttctcccagcgtggttacaacattgaaagtctgacggtagcgccgaccgacgat cctacgttgtcgcgtatgaccatccaaaccgtcggcgatgagaaagtgctggagcagatc gaaaagcagctgcataagctggtggatgtgctgcgcgtcagcgagctggtgcagggcgcg catgttgagcgcgagatcatgctggtgaagctgcaggccagcggttatggccgtgaagag gtgaaacgctgcgccgatattttccgtgggcagattgtcgatgtcacggcgacgctttac accgttcagctggccggcaccagcgacaagctggatgcgtttcttaatgcagtgcgcgaa gtggctgaaattgtcgaagtggcgcgttccggcgtcgtcggcgtgtcgcgcggcgataaa atcatgcgctga

DBGET integrated database retrieval system