Shewanella sediminis: Ssed_1078 Help Entry Ssed_1078         CDS       T00596                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism sse  Shewanella sediminis Pathway sse00790   Folate biosynthesis sse01100   Metabolic pathways sse01240   Biosynthesis of cofactors Module sse_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:sse00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Ssed_1078 Enzymes [BR:sse01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Ssed_1078  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Ssed_1078  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Ssed_1078 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ABV35689 UniProt:  A8FS66 LinkDB All DBs Position 1280011..1280364 Genome browser AA seq 117 aa AA seqDB search MDRVLIRQLKIETVIGVYEWEKKIHQSLLIDLDMAWDNKPAAASDDYQHALCYETVSNRL TALITEKPIELIETVAEMTANCLMTEFSVPWVKVTVMKPGAVPSAAAVGVEIERGQY NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggacagggttttaatacgacagttaaagatagaaactgttatcggagtttatgagtgg gaaaaaaagatccatcaaagcttacttatcgatctcgatatggcttgggataataaaccc gctgcggcgagtgatgattaccagcatgcactctgctatgaaacggtttcgaaccgactc acagctttaatcaccgaaaagccgattgagttgattgaaactgtagccgaaatgaccgct aactgtttgatgaccgagtttagtgtaccttgggtaaaagtgacggtaatgaagcctggg gctgtacctagcgccgctgcggtgggtgtcgaaattgagcggggtcaatattaa

DBGET integrated database retrieval system