Streptomyces seoulensis: D0Z67_27260 Help Entry D0Z67_27260       CDS       T07029                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sseo  Streptomyces seoulensis Pathway sseo00261   Monobactam biosynthesis sseo01100   Metabolic pathways sseo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sseo00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     D0Z67_27260  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sseo01008]     D0Z67_27260 Polyketide biosynthesis proteins [BR:sseo01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     D0Z67_27260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QBJ93608 UniProt:  A0A4P6U5X7 LinkDB All DBs Position complement(5946149..5946331) Genome browser AA seq 60 aa AA seqDB search MAQTYRVVVNGEEQYSIWPEEQKLPAGWFDEGTSGSKEDCLAHVEQVWTDMRPLSLRRAR NT seq 183 nt NT seq  +upstreamnt  +downstreamnt gtggcacagacgtaccgcgtagtggtgaacggcgaggagcagtactcgatctggccggag gagcaaaagctgcccgccggctggttcgacgagggcacgtccggctccaaggaggactgc ctcgcccacgtcgaacaggtgtggaccgacatgcggccgctcagtctccgccgggcgcgg tga

DBGET integrated database retrieval system