Streptomyces alfalfae: A7J05_12155 Help Entry A7J05_12155       CDS       T05110                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism ssia  Streptomyces alfalfae Pathway ssia00261   Monobactam biosynthesis ssia01100   Metabolic pathways ssia01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssia00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     A7J05_12155  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ssia01008]     A7J05_12155 Polyketide biosynthesis proteins [BR:ssia01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     A7J05_12155 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  APY86367 UniProt:  A0A1P8TFI3 LinkDB All DBs Position complement(3049144..3049350) Genome browser AA seq 68 aa AA seqDB search MAGNPFEDESGQYLVLVNDENQHALWPAPLDVPAGWEVAQEASSRADSLAYVERSWTDMR PASLISGS NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggcggggaatccattcgaagatgagagtggtcaatatctggtgctcgtcaacgacgag aaccagcacgccctctggcccgcgccgctcgacgtgccggcgggctgggaggtggcacaa gaggcgagttcacgggccgattcactggcctatgtggagcggagctggacggacatgcgt ccggcgagcctgatatccggttcctga

DBGET integrated database retrieval system