Streptomyces alfalfae: A7J05_35865 Help Entry A7J05_35865       CDS       T05110                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism ssia  Streptomyces alfalfae Pathway ssia00261   Monobactam biosynthesis ssia01100   Metabolic pathways ssia01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssia00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     A7J05_35865  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ssia01008]     A7J05_35865 Polyketide biosynthesis proteins [BR:ssia01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     A7J05_35865 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  APY90321 UniProt:  A0A1P8TRR9 LinkDB All DBs Position 8398751..8399011 Genome browser AA seq 86 aa AA seqDB search MTPKPADDDRLYKVVVNHEEQYSVWPAGRDNPAGWSDAGRTGPKADCLAHIEDVWTDMRP LSLRRLREGEQDPHDAPLAEGTDRSG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacaccgaaacccgccgatgacgaccggctgtacaaggtcgtggtcaaccacgaggag cagtactccgtctggcccgccggccgggacaatccggccgggtggtcggacgcgggaagg accggcccgaaggccgactgcctcgctcatatcgaggacgtgtggaccgacatgcgcccc ctgagcctgcgccgcctgcgggagggcgaacaggacccacacgacgcgccattggccgag ggaaccgaccggtcgggctga

DBGET integrated database retrieval system