Sclerotinia sclerotiorum: SS1G_07307 Help Entry SS1G_07307        CDS       T01071                                  Name (RefSeq) hypothetical protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism ssl  Sclerotinia sclerotiorum Pathway ssl03020   RNA polymerase ssl03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ssl00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     SS1G_07307   09124 Replication and repair    03420 Nucleotide excision repair     SS1G_07307  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ssl03021]     SS1G_07307    03400 DNA repair and recombination proteins [BR:ssl03400]     SS1G_07307 Transcription machinery [BR:ssl03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      SS1G_07307   RNA polymerase III system    RNA polymerase III      SS1G_07307   RNA polymerase I system    RNA polymerase I      SS1G_07307 DNA repair and recombination proteins [BR:ssl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       SS1G_07307 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  5488016 NCBI-ProteinID:  XP_001591861 UniProt:  A0A1D9Q5K7 A7EPQ8 LinkDB All DBs Position Unknown AA seq 165 aa AA seqDB search MSDDEGDYDGGFSPAYDADEPEEPDYDPEGIEDTNNVSTGEVDDVAVSTQNPDQLLTTGE RGVVTSGDLHAANRAKSNIAPKDKKIPKEQRTTTPYMTKYERARILGTRALQISMNAPIL VDQEGETDPLQIAIKELRDKKIPLIVRRYMPDGWYEDWTCEELLQ NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atgtctgacgacgaaggagattatgatggaggtttctccccagcctacgacgcagatgag cccgaagagcccgactatgatcccgaaggaattgaagacaccaacaacgtttccacgggc gaagtagacgacgtggcagtatcgactcaaaatcccgaccagctactcactactggcgaa cgcggcgtcgtaacatcgggcgatttacatgctgctaatcgagctaagagcaatatcgcg cccaaggacaagaaaattcccaaggagcaaagaactactactccctacatgaccaaatac gagcgcgccagaatcttgggaactagagccttgcaaatcagtatgaatgcgccgattttg gttgatcaggagggcgagacggatcctctgcagattgccattaaggagttgagggataag aagattccgttgattgtgagacgttatatgcctgatggatggtatgaagattggacttgc gaagaattgctgcagtga

DBGET integrated database retrieval system