Streptomyces solisilvae: I1A49_44245 Help Entry I1A49_44245       CDS       T07406                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ssoi  Streptomyces solisilvae Pathway ssoi00261   Monobactam biosynthesis ssoi01100   Metabolic pathways ssoi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssoi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     I1A49_44245  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ssoi01008]     I1A49_44245 Polyketide biosynthesis proteins [BR:ssoi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     I1A49_44245 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QPI60992 LinkDB All DBs Position 10952077..10952295 Genome browser AA seq 72 aa AA seqDB search MSNPFDDADARYLVLVNDEGQYSLWPVFAEVPAGWTAVHGPDGRQACLDHINENWTDMRP KSLVEAMDSATS NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagcaaccccttcgacgacgccgacgccaggtatctggtgctggtcaacgacgagggc cagtactccctgtggccggtcttcgccgaggtcccggccggctggacggctgtccacggc cccgacgggcggcaggcgtgcctggatcacatcaacgagaactggaccgacatgcgcccg aagagcctggtcgaggccatggactcggccacctcctga

DBGET integrated database retrieval system