Streptomyces spectabilis: CP982_06890 Help Entry CP982_06890       CDS       T07323                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism sspb  Streptomyces spectabilis Pathway sspb00261   Monobactam biosynthesis sspb01100   Metabolic pathways sspb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sspb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP982_06890  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sspb01008]     CP982_06890 Polyketide biosynthesis proteins [BR:sspb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP982_06890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEV58465 UniProt:  A0A5P2X5Q7 LinkDB All DBs Position complement(1725679..1725894) Genome browser AA seq 71 aa AA seqDB search MADDLNDDRLYRVVRNDEEQYSIWAADREPPAGWHAEGTEGTRQECLDRIDTVWTDMRPA SLRRRMEQAGT NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggctgacgacctcaacgacgaccgcctctaccgcgtcgtccgcaacgacgaggagcag tactcgatctgggccgccgaccgcgagccgcccgccggctggcacgccgagggcaccgag ggcacccgccaagagtgcctggaccggatcgacaccgtctggaccgacatgcgcccggcg agcctgcgccgccgcatggagcaggcgggcacctga

DBGET integrated database retrieval system