Streptomyces spectabilis: CP982_34375 Help Entry CP982_34375       CDS       T07323                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sspb  Streptomyces spectabilis Pathway sspb00261   Monobactam biosynthesis sspb01100   Metabolic pathways sspb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sspb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP982_34375  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sspb01008]     CP982_34375 Polyketide biosynthesis proteins [BR:sspb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP982_34375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEV63167 UniProt:  A0A516RGK0 LinkDB All DBs Position complement(7898309..7898533) Genome browser AA seq 74 aa AA seqDB search MSSNPFDDADGRFYILVNDEEQHSLWPSFAEVPAGWRVTFGEASRQECLDYVEQNWTDLR PKSLRDAMAADKAA NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgagcagcaacccgttcgacgacgcggacggccggttctacatcctggtgaacgacgag gagcagcactcgctgtggccgtccttcgccgaggtgcccgccggctggcgggtcacgttc ggtgaggcgagccgtcaggagtgcctggactacgtggagcagaactggaccgacctgcgg cccaagagcctccgcgacgcgatggcggcggacaaggctgcgtga

DBGET integrated database retrieval system