Streptomyces spectabilis: CP982_35945 Help Entry CP982_35945       CDS       T07323                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sspb  Streptomyces spectabilis Pathway sspb00261   Monobactam biosynthesis sspb01100   Metabolic pathways sspb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sspb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP982_35945  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sspb01008]     CP982_35945 Polyketide biosynthesis proteins [BR:sspb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP982_35945 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEV63433 UniProt:  A0A5P2XEY2 LinkDB All DBs Position complement(8446115..8446318) Genome browser AA seq 67 aa AA seqDB search MTDDRVYQIVVNHEEQYSIWDSEMDIPAGWSPVGVSGSRAECLAHIERTWTDITPLSVRK KYAEASA NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgaccgacgaccgcgtctatcagattgttgtcaatcacgaggaacagtactcgatctgg gactccgagatggacatacccgcaggctggagccctgtcggagtctccggcagcagagcg gaatgcctggctcacatcgagcggacctggaccgacatcaccccgctgagcgtacggaag aagtatgccgaggcatcggcctga

DBGET integrated database retrieval system