Streptomyces spectabilis: CP982_39280 Help Entry CP982_39280       CDS       T07323                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sspb  Streptomyces spectabilis Pathway sspb00261   Monobactam biosynthesis sspb01100   Metabolic pathways sspb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sspb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP982_39280  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sspb01008]     CP982_39280 Polyketide biosynthesis proteins [BR:sspb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP982_39280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEV63997 UniProt:  A0A5P2XG42 LinkDB All DBs Position 9263513..9263725 Genome browser AA seq 70 aa AA seqDB search MSTNPFDDTEGRFLVLTNEEGQHSLWPSFAEVPGGWTVVFAENTRDACLEYVESHWTDLR PRSLAAAMDA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaacccgtttgacgataccgaaggccgcttcctggtcctgacgaacgaggag ggccagcactcgctgtggccgtcgttcgccgaggtccccggcggatggacggtcgtcttc gcggagaacacgcgcgacgcctgcctggagtacgtcgagtcccactggaccgacctgcgc ccccgctccctcgccgcggccatggacgcctga

DBGET integrated database retrieval system