Streptomyces spongiicola: DDQ41_25575 Help Entry DDQ41_25575       CDS       T06937                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sspo  Streptomyces spongiicola Pathway sspo00261   Monobactam biosynthesis sspo01100   Metabolic pathways sspo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sspo00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DDQ41_25575  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sspo01008]     DDQ41_25575 Polyketide biosynthesis proteins [BR:sspo01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DDQ41_25575 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AWK11724 UniProt:  A0A2S1Z5S4 LinkDB All DBs Position 5857121..5857333 Genome browser AA seq 70 aa AA seqDB search MSTNPFDDENGRFHVLVNDEEQHCLWPAFAEVPAGWRSVLGPAGRAESVAYVEENWTDLR PRSLREAMNA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt gtgagcaccaatccgttcgacgacgagaacggccggttccacgtgctggtcaacgacgag gaacagcactgcctctggcctgccttcgccgaggtgcctgcgggctggcgcagtgtcctc ggccccgcgggaagagcggagagcgtggcctacgtggaggagaactggaccgacctgcgg ccgcgaagtcttcgggaggcgatgaacgcctag

DBGET integrated database retrieval system