Saccharothrix syringae: EKG83_19020 Help Entry EKG83_19020       CDS       T06258                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ssyi  Saccharothrix syringae Pathway ssyi00261   Monobactam biosynthesis ssyi01100   Metabolic pathways ssyi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssyi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     EKG83_19020  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ssyi01008]     EKG83_19020 Polyketide biosynthesis proteins [BR:ssyi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     EKG83_19020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QFZ19255 UniProt:  A0A5Q0GZZ1 LinkDB All DBs Position 4372932..4373129 Genome browser AA seq 65 aa AA seqDB search MTNPFDDPEGSFHVLVNDEEQHSLWPSFAEVPAGWTSRFGPDTREACLAYVEEHWTDLRP LGLRG NT seq 198 nt NT seq  +upstreamnt  +downstreamnt gtgaccaaccccttcgacgaccccgagggcagcttccacgtcctggtcaacgacgaggag cagcactcgctgtggccgtcgttcgccgaggtcccggccggctggaccagccggttcggc ccggacacccgcgaggcgtgcctggcctacgtggaggagcactggaccgacctgaggccg ctcggcctgcgcggctga

DBGET integrated database retrieval system