Saccharothrix syringae: EKG83_30680 Help Entry EKG83_30680       CDS       T06258                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ssyi  Saccharothrix syringae Pathway ssyi00261   Monobactam biosynthesis ssyi01100   Metabolic pathways ssyi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssyi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     EKG83_30680  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ssyi01008]     EKG83_30680 Polyketide biosynthesis proteins [BR:ssyi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     EKG83_30680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QFZ21170 UniProt:  A0A5Q0H5Q3 LinkDB All DBs Position complement(7265689..7265889) Genome browser AA seq 66 aa AA seqDB search MGIDDADTTFQVVVNDQDQYSIWFADRSLPAGWSAVGTTGSKQECLQHIEKVWTDMRPRS VRERVR NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgggcatcgacgacgccgacacgaccttccaggtcgtcgtcaacgaccaggaccagtac tcgatctggttcgccgaccgctccctgcccgccggctggagcgccgtcgggaccaccggc agcaagcaggaatgccttcagcacatcgagaaggtgtggaccgacatgaggccccgttcg gttcgcgaacgcgtccgctga

DBGET integrated database retrieval system