Streptomyces tanashiensis: LDH80_04295 Help Entry LDH80_04295       CDS       T08718                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism staa  Streptomyces tanashiensis Pathway staa00261   Monobactam biosynthesis staa01100   Metabolic pathways staa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:staa00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LDH80_04295  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:staa01008]     LDH80_04295 Polyketide biosynthesis proteins [BR:staa01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LDH80_04295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UZX19983 LinkDB All DBs Position complement(925319..925534) Genome browser AA seq 71 aa AA seqDB search MSESVNPFDNAEGTFHVVVNDEGQHSLWPAFADIPAGWTSVWGTGNRADALDYITANWTD IRPRGLVAQYA NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagcgagtccgtcaacccgttcgacaacgccgagggcaccttccacgtcgtcgtgaac gacgagggtcagcactccctgtggcccgccttcgcggacatcccggcaggctggaccagc gtctggggcaccggaaaccgcgccgacgccctggactacatcaccgccaactggaccgac atccgcccgcgcggcctcgtcgcccagtacgcctga

DBGET integrated database retrieval system