Streptomyces tanashiensis: LDH80_10550 Help Entry LDH80_10550       CDS       T08718                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism staa  Streptomyces tanashiensis Pathway staa00261   Monobactam biosynthesis staa01100   Metabolic pathways staa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:staa00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LDH80_10550  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:staa01008]     LDH80_10550 Polyketide biosynthesis proteins [BR:staa01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LDH80_10550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UZX21131 LinkDB All DBs Position complement(2345160..2345372) Genome browser AA seq 70 aa AA seqDB search MTHPFEDPDGSYLVLVNDEEQYSLWPAPTAVPAGWRSVMGPADRAACLDHVESAWLDMRP KSLIGSMEGA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgacccaccccttcgaggacccggacggcagctacctcgtcctggtcaacgacgaggag cagtactccctctggcccgcgcccaccgccgtaccggcgggctggcgcagcgtcatgggg ccggcggaccgggcggcatgcctggatcacgtcgagtccgcgtggctcgacatgcgcccc aagagcctgatcgggtcgatggagggcgcatga

DBGET integrated database retrieval system