Sporomusa termitida: SPTER_04250 Help Entry SPTER_04250       CDS       T06115                                  Name (GenBank) 4Fe-4S binding domain protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism sted  Sporomusa termitida Pathway sted00020   Citrate cycle (TCA cycle) sted01100   Metabolic pathways sted01110   Biosynthesis of secondary metabolites sted01120   Microbial metabolism in diverse environments sted01200   Carbon metabolism sted01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:sted00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     SPTER_04250 Enzymes [BR:sted01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      SPTER_04250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_9 Fer4_7 Fer4_10 Fer4_2 Fer4_16 Fer4_6 Fer4_21 Fer4_8 Fer4_4 Fer4_17 Fer4_22 Fer4_3 Fer4_13 Fer4_15 Motif Other DBs NCBI-ProteinID:  QDR79157 UniProt:  A0A517DPD6 LinkDB All DBs Position 482615..482800 Genome browser AA seq 61 aa AA seqDB search MLKTKPRFCKGCGICVEFCPKKVLKLDDLAKIEVAQPDDCVACGQCELRCPDYAIFVIAD K NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgctgaaaactaagccccggttttgcaaaggatgtggcatttgtgttgagttttgtccc aagaaggtactgaagctggatgaccttgccaaaatagaggtcgctcagccggatgactgt gtggcttgcgggcaatgtgaattaagatgtcctgattatgctatttttgtcattgctgat aagtaa

DBGET integrated database retrieval system