Stella sp. ATCC 35155: STAQ_42100 Help Entry STAQ_42100        CDS       T07954                                  Symbol soxD_2 Name (GenBank) sarcosine oxidase subunit delta   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism stel  Stella sp. ATCC 35155 Pathway stel00260   Glycine, serine and threonine metabolism stel01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:stel00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     STAQ_42100 (soxD_2) Enzymes [BR:stel01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      STAQ_42100 (soxD_2)     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      STAQ_42100 (soxD_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Lar_restr_allev Motif Other DBs NCBI-ProteinID:  BBK39132 LinkDB All DBs Position 4470281..4470562 Genome browser AA seq 93 aa AA seqDB search MLLIPCPWCGLRDEAEFHCGGESHVVRPPDPDAADDAAWAAYLFDRDNAKGVGFERWLHR HGCGRWFNVARDTVTHEIRAVYGMTDPRPETAS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgctgctgattccctgcccctggtgcgggttgcgcgacgaggccgagttccactgcggc ggcgagagccatgtcgtccggccacccgaccccgatgccgccgacgacgccgcctgggcc gcctacctgttcgaccgggacaatgcgaagggggtcgggttcgagcgctggctgcaccgc cacggctgcggccgctggttcaacgtcgcccgcgacaccgtcacccacgagatccgggcg gtctacggcatgaccgatccacggcccgagaccgcgtcgtga

DBGET integrated database retrieval system