Symbiobacterium thermophilum: STH221 Help Entry STH221            CDS       T00196                                  Name (GenBank) putative ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism sth  Symbiobacterium thermophilum Pathway sth00020   Citrate cycle (TCA cycle) sth01100   Metabolic pathways sth01110   Biosynthesis of secondary metabolites sth01120   Microbial metabolism in diverse environments sth01200   Carbon metabolism sth01210   2-Oxocarboxylic acid metabolism Module sth_M00009   Citrate cycle (TCA cycle, Krebs cycle) sth_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:sth00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     STH221 Enzymes [BR:sth01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      STH221 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_6 Fer4 Fer4_2 Fer4_7 Fer4_21 Fer4_10 Fer4_9 Fer4_4 Fer4_8 Fer4_15 Fer4_16 Fer4_13 Fer4_17 Fer4_3 Fer4_22 Motif Other DBs NCBI-ProteinID:  BAD39206 UniProt:  Q67SY7 LinkDB All DBs Position 245010..245231 Genome browser AA seq 73 aa AA seqDB search MGLRGIKLEMNQDRCKGCELCTEACPREVLAMGNQINALGYRAAVAIAPERCTGCRACAL VCPEVVFTIYKIA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggggttgcgcggcatcaagctcgagatgaatcaggatcgctgcaagggatgcgagctt tgcacggaggcctgcccgcgcgaggtgctcgccatggggaaccagatcaacgcgctgggc tatcgggcggccgtggccatcgctccggagcggtgcaccggctgccgggcgtgcgcgctg gtctgccctgaggtcgtcttcaccatttacaagatcgcctag

DBGET integrated database retrieval system