Streptomyces tirandamycinicus: DDW44_27565 Help Entry DDW44_27565       CDS       T06843                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism stir  Streptomyces tirandamycinicus Pathway stir00261   Monobactam biosynthesis stir01100   Metabolic pathways stir01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stir00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DDW44_27565  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:stir01008]     DDW44_27565 Polyketide biosynthesis proteins [BR:stir01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DDW44_27565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AWI32134 UniProt:  A0A2S1T0D6 LinkDB All DBs Position 6318413..6318625 Genome browser AA seq 70 aa AA seqDB search MSNPFEDDNAAYLVLVNDENQHSLWPVWIDVPAGWTTVHGEAPRQECLDWIEANWTDIRP ASLLAALDPR NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccgttcgaggacgacaacgccgcctatctggtcctggtcaacgacgagaac cagcactcgctctggccggtctggatcgacgtgccggccggctggaccaccgtccacggc gaggccccccgccaggagtgcctcgactggatcgaggccaactggaccgacatccgcccg gcgagcctgctcgccgccctcgacccgcggtga

DBGET integrated database retrieval system