Salinispora tropica: Strop_2726 Help Entry Strop_2726        CDS       T00504                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism stp  Salinispora tropica Pathway stp00261   Monobactam biosynthesis stp01100   Metabolic pathways stp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Strop_2726  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:stp01008]     Strop_2726 Polyketide biosynthesis proteins [BR:stp01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Strop_2726 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABP55170 UniProt:  A4X8H0 LinkDB All DBs Position 3072733..3072942 Genome browser AA seq 69 aa AA seqDB search MTSPFDIEDGTYVVLVNAENQHSLWPHAVEVPAGWSVVCGPTGRSSCLEYVSTHWADLRP RSLLAELNN NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgaccagtccctttgacatcgaggacggcacgtatgtcgtgttggtcaacgcggagaac caacactcgctgtggccgcatgccgtcgaggtaccggcgggatggtccgtcgtctgcggt ccgactggccgttcttcctgcctcgagtacgtcagtacgcactgggctgatctgcgcccg cgcagtcttctggccgagctgaacaattga

DBGET integrated database retrieval system