Salinispora tropica: Strop_4421 Help Entry Strop_4421        CDS       T00504                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism stp  Salinispora tropica Pathway stp00261   Monobactam biosynthesis stp01100   Metabolic pathways stp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Strop_4421  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:stp01008]     Strop_4421 Polyketide biosynthesis proteins [BR:stp01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Strop_4421 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABP56849 UniProt:  A4XD42 LinkDB All DBs Position complement(5014271..5014480) Genome browser AA seq 69 aa AA seqDB search MEESEDPRPYHVVVNDEEQYSIWPDGSEIPAGWRTVGFSGDRASCLAHIEEVWTDLRPRG LREWLAAQG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagaatccgaggacccgcgcccctaccacgtcgtggtgaacgacgaggagcagtac tcgatctggccggacgggtcggagattccggccgggtggcgcacggtgggcttcagtggc gatcgcgccagctgcctcgcccacatcgaggaggtttggactgatttgcgcccacgtggg ctgcgggagtggctggcagcccagggctga

DBGET integrated database retrieval system