Streptomyces sp. CNQ-509: AA958_18110 Help Entry AA958_18110       CDS       T03968                                  Name (GenBank) diguanylate cyclase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism strc  Streptomyces sp. CNQ-509 Pathway strc00790   Folate biosynthesis strc01100   Metabolic pathways strc01240   Biosynthesis of cofactors Module strc_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:strc00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     AA958_18110 Enzymes [BR:strc01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      AA958_18110  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      AA958_18110  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      AA958_18110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Rv2993c-like_N TGS Motif Other DBs NCBI-ProteinID:  AKH83804 UniProt:  A0A0F7N8L6 LinkDB All DBs Position 4257202..4257570 Genome browser AA seq 122 aa AA seqDB search MTQADRVALRGLRARGHHGVFAHERAEGQPFVVDLVLHLDTRPAAATDDLARTVHYGVVA EETVAIVEGEPVDLIETLAERIAAQCLTHAPVQQVEVTVHKPDAPITVPFDDVTITITRS RG NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgacccaggccgaccgagtcgcgctgcgcggcctcagggcccgcggccaccacggcgtc ttcgcgcacgagcgcgccgagggccaaccgttcgtcgtcgacctcgtcctccacctcgac acccgccccgccgctgccaccgacgacctggcgcggaccgtgcactacggcgtcgtggcg gaggagaccgtggccatcgtcgagggcgagccggtggacctgatcgagacgctcgccgag cggatcgccgcgcagtgcctgacccacgcgcccgtgcagcaggtggaggtgacggtgcac aagccggacgcgccgatcaccgttccgttcgacgacgtgaccatcaccatcacccgaagc agaggttga

DBGET integrated database retrieval system