Streptomyces sp. CNQ-509: AA958_29280 Help Entry AA958_29280       CDS       T03968                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism strc  Streptomyces sp. CNQ-509 Pathway strc00261   Monobactam biosynthesis strc01100   Metabolic pathways strc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strc00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AA958_29280  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:strc01008]     AA958_29280 Polyketide biosynthesis proteins [BR:strc01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AA958_29280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AKH85656 UniProt:  A0A0F7NBU6 LinkDB All DBs Position 6814906..6815127 Genome browser AA seq 73 aa AA seqDB search MTDTVNAFDVPDARYHVLVNPEGQYSLWPALTDVPAGWEPVHGPAGRAQCVEYVESNWTD MRPATLRVALDEV NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacggatacggtcaacgcgttcgacgtccccgacgcgcgataccacgtgctggtcaac ccggagggccagtattcactgtggccggcactcaccgatgtgccggccggatgggagccg gtgcacggtccggcgggacgggcgcagtgcgtcgagtacgtcgagagcaattggaccgac atgcgacccgcaacgctgagagtcgctctcgacgaggtgtga

DBGET integrated database retrieval system