Streptomyces sp. CNQ-509: AA958_31895 Help Entry AA958_31895       CDS       T03968                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism strc  Streptomyces sp. CNQ-509 Pathway strc00261   Monobactam biosynthesis strc01100   Metabolic pathways strc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strc00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AA958_31895  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:strc01008]     AA958_31895 Polyketide biosynthesis proteins [BR:strc01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AA958_31895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AKH86056 UniProt:  A0A0F7NCX3 LinkDB All DBs Position 7476935..7477165 Genome browser AA seq 76 aa AA seqDB search MANPFDNENGTFLVLVNDENQHSLWPAFAEVPAGWKSVFGEESRKACMDYIEENWTDMRP KSLIDEMDRQEQAAAR NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcgaatccgttcgacaacgagaacggcactttcctggtcctggtcaacgatgagaac cagcattccctctggcccgccttcgccgaagtccccgccggttggaagtccgtgttcggc gaggagagccgcaaggcgtgcatggactacatcgaggagaactggaccgacatgcggccg aagagcctgatcgacgagatggacaggcaggagcaggccgccgcccgctag

DBGET integrated database retrieval system