Streptomyces sp. CCM_MD2014: NI25_01065 Help Entry NI25_01065        CDS       T04862                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism strd  Streptomyces sp. CCM_MD2014 Pathway strd00261   Monobactam biosynthesis strd01100   Metabolic pathways strd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NI25_01065  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:strd01008]     NI25_01065 Polyketide biosynthesis proteins [BR:strd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NI25_01065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIV32280 UniProt:  A0A0N6ZDV5 LinkDB All DBs Position complement(224640..224852) Genome browser AA seq 70 aa AA seqDB search MSTNPFDDTDGRFLVLVNHEGQHSLWPSFAQVPGGWTVAFEENTRDACLEYVETNWTDLR PRSLAESADS NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaacccgttcgacgacaccgacggccgcttcctcgtcctcgtcaaccacgag ggacagcactcgctgtggccctccttcgcccaggtgcccggcggatggaccgtcgccttc gaggagaacacccgggacgcctgcctggagtacgtcgagaccaactggacggacctgcgc ccccgttccctggccgagtccgccgattcctga

DBGET integrated database retrieval system