Streptomyces sp. 769: GZL_00058 Help Entry GZL_00058         CDS       T03587                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism stre  Streptomyces sp. 769 Pathway stre00261   Monobactam biosynthesis stre01100   Metabolic pathways stre01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stre00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     GZL_00058  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:stre01008]     GZL_00058 Polyketide biosynthesis proteins [BR:stre01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     GZL_00058 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJC52666 UniProt:  A0A0A8EF65 LinkDB All DBs Position complement(56294..56527) Genome browser AA seq 77 aa AA seqDB search MTSCGDKESTMTHPFDDPDGVYQVLVNEEQQQSLWPRDVRAPAGWSPVFGPDTRDACVDY VESHWLDLRPASTRAAR NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtgaccagctgcggcgacaaggagagcaccatgacgcatcccttcgacgaccccgacggc gtctaccaggttctcgtcaacgaggaacagcagcaaagcctttggccgcgcgacgtccgc gcgcccgccggctggtcgccggtgttcggcccggacacgcgggacgcctgcgtcgactac gtcgagtcccactggctcgacctgcgcccggcctcgacgcgggcggctcggtga

DBGET integrated database retrieval system