Streptomyces sp. 769: GZL_02924 Help Entry GZL_02924         CDS       T03587                                  Name (GenBank) putative MbtH-like protein   KO K05375   MbtH protein Organism stre  Streptomyces sp. 769 Pathway stre00261   Monobactam biosynthesis stre01100   Metabolic pathways stre01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stre00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     GZL_02924  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:stre01008]     GZL_02924 Polyketide biosynthesis proteins [BR:stre01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     GZL_02924 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJC55511 UniProt:  A0A0A8ENC0 LinkDB All DBs Position complement(3087768..3087980) Genome browser AA seq 70 aa AA seqDB search MSANPFENDEAFYLVLRNTEGQHSLWPSFAEVPQGWEVAFGPQLRQECLEFVNENWTDMR PKSLIEAMGA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtccgccaaccccttcgagaatgacgaagccttctacctggtgctccgcaacaccgag ggacagcactccctgtggcccagtttcgccgaggtcccccagggctgggaggtcgccttc ggcccgcaactgcgccaggaatgcctggaattcgtcaacgagaactggaccgacatgcgc cccaagtccctgatcgaggccatgggtgcctga

DBGET integrated database retrieval system