Streptomyces sp. 769: GZL_04271 Help Entry GZL_04271         CDS       T03587                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism stre  Streptomyces sp. 769 Pathway stre00790   Folate biosynthesis stre01100   Metabolic pathways stre01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:stre00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     GZL_04271 Enzymes [BR:stre01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      GZL_04271  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      GZL_04271  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      GZL_04271 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Spore_YhcN_YlaJ Rv2993c-like_N TGS Motif Other DBs NCBI-ProteinID:  AJC56849 UniProt:  A0A0A8EM10 LinkDB All DBs Position complement(4619544..4619855) Genome browser AA seq 103 aa AA seqDB search MFPREREEGQTFIVDLVLGLDTRPAAASDDLAKTVHYGIVAEEVVAVVEGEPVDLIETLA ERIADQCLKHEGVQEVEVVVHKPDAPITVPFDDVTITITRSRV NT seq 312 nt NT seq  +upstreamnt  +downstreamnt gtgttcccccgggagcgcgaggaaggccagaccttcatcgtcgacctggtcctcggcctg gacacccgcccggcggcggcctccgacgatctcgcgaagaccgtccactacggcatcgtc gccgaggaggtggtggccgtcgtcgaaggcgagcccgtcgacctcatcgagaccctggcg gagcgcatcgccgaccagtgcctgaagcacgagggggtgcaggaggtggaagtggtggtc cacaagccggacgcaccgatcaccgtccccttcgatgacgtgaccatcaccatcactcgg agccgagtatga

DBGET integrated database retrieval system