Streptomyces sp. 769: GZL_08294 Help Entry GZL_08294         CDS       T03587                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism stre  Streptomyces sp. 769 Pathway stre00261   Monobactam biosynthesis stre01100   Metabolic pathways stre01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stre00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     GZL_08294  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:stre01008]     GZL_08294 Polyketide biosynthesis proteins [BR:stre01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     GZL_08294 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJC60830 UniProt:  A0A0A8EX92 LinkDB All DBs Position 8902732..8902950 Genome browser AA seq 72 aa AA seqDB search MANVFDDEFARFIVLVNEERQYSLWPATTEVPGGWQVARPEGSRQECLEFVESTWTDMRP ASLVAAMEAQGS NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggccaatgtttttgacgatgagtttgcccgattcatcgttctggtcaatgaggagcgt cagtactcgctctggcccgccaccacagaggtgccgggtggatggcaggttgcgcggccg gaggggtcgcgccaggagtgcctggagttcgtcgagtccacctggacggacatgcgaccg gccagtctggtcgccgccatggaggctcagggctcctag

DBGET integrated database retrieval system