Streptomyces sp. 769: GZL_09355 Help Entry GZL_09355         CDS       T03587                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism stre  Streptomyces sp. 769 Pathway stre00261   Monobactam biosynthesis stre01100   Metabolic pathways stre01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stre00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     GZL_09355  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:stre01008]     GZL_09355 Polyketide biosynthesis proteins [BR:stre01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     GZL_09355 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJC61873 UniProt:  A0A0A8F1Q6 LinkDB All DBs Position 10044245..10044481 Genome browser AA seq 78 aa AA seqDB search MVTSCGDKESTMTHPFDDPDGVYQVLVNEEQQQSLWPRDVRAPAGWSPVFGPDTRDACVD YVESHWLDLRPASTRAAR NT seq 237 nt NT seq  +upstreamnt  +downstreamnt gtggtgaccagctgcggcgacaaggagagcaccatgacgcatcccttcgacgaccccgac ggcgtctaccaggttctcgtcaacgaggaacagcagcaaagcctttggccgcgcgacgtc cgcgcgcccgccggctggtcgccggtgttcggcccggacacgcgggacgcctgcgtcgac tacgtcgagtcccactggctcgacctgcgcccggcctcgacgcgggcggctcggtga

DBGET integrated database retrieval system