Streptomyces sp. 4F: ASR50_26680 Help Entry ASR50_26680       CDS       T04265                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism strf  Streptomyces sp. 4F Pathway strf00261   Monobactam biosynthesis strf01100   Metabolic pathways strf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     ASR50_26680  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:strf01008]     ASR50_26680 Polyketide biosynthesis proteins [BR:strf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     ASR50_26680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ALV52649 LinkDB All DBs Position complement(6001215..6001433) Genome browser AA seq 72 aa AA seqDB search MANPFENDEASYFVLVNDEGQHSLWPAFAEVPAGWRKVHGEDTRAACLAYVEENWTDMRP LSLVRAMEADAA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt gtggccaatccgttcgagaacgacgaggcgtcatacttcgtgctcgtcaacgacgagggc cagcattcgctgtggccggcgttcgccgaggtcccggcgggctggcggaaggtgcacggt gaggacacccgcgccgcctgcctcgcctacgtggaggagaactggaccgacatgcgtccg ctcagcctggtacgcgcgatggaagccgacgcggcgtga

DBGET integrated database retrieval system