Streptacidiphilus sp. P02-A3a: GXP74_20080 Help Entry GXP74_20080       CDS       T08580                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism strh  Streptacidiphilus sp. P02-A3a Pathway strh00261   Monobactam biosynthesis strh01100   Metabolic pathways strh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strh00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     GXP74_20080  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:strh01008]     GXP74_20080 Polyketide biosynthesis proteins [BR:strh01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     GXP74_20080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 DUF5076 Motif Other DBs NCBI-ProteinID:  QMU70181 LinkDB All DBs Position complement(4608011..4608226) Genome browser AA seq 71 aa AA seqDB search MSTNPFEDPDSTYRVLVNDEGQHSLWPSFAETPAGWTTVLAETDRQSALDYVEAHWTDLR PRSLVAVMDQR NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatccgttcgaggacccggacagcacgtaccgtgtgctggtcaacgacgag ggccagcactccctttggccctccttcgccgagacgccggcgggctggacgacggttctg gccgagaccgaccggcagtcggcgctcgactacgtcgaggcgcactggaccgaccttcgg cccagaagcctggtggcggtgatggaccagcgctag

DBGET integrated database retrieval system