Streptacidiphilus sp. P02-A3a: GXP74_28745 Help Entry GXP74_28745       CDS       T08580                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism strh  Streptacidiphilus sp. P02-A3a Pathway strh00261   Monobactam biosynthesis strh01100   Metabolic pathways strh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strh00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     GXP74_28745  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:strh01008]     GXP74_28745 Polyketide biosynthesis proteins [BR:strh01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     GXP74_28745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QMU71638 LinkDB All DBs Position 6787074..6787265 Genome browser AA seq 63 aa AA seqDB search MTDETEDLQTYLVVVNHEEQYSVWRADRELPNGWDSIGSPATRAECLARIEEQWTDMRPL SVR NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgactgacgagaccgaggacctgcagacctacctggtggtcgtcaaccacgaggagcag tactccgtgtggcgcgcggaccgcgagctgccgaacggctgggactccatcggatcgccg gccaccagggccgagtgcctcgcccgcatcgaggagcagtggacggacatgcgcccgctc agcgtccgctga

DBGET integrated database retrieval system