Peterkaempfera bronchialis: C7M71_026765 Help Entry C7M71_026765      CDS       T05561                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism stri  Peterkaempfera bronchialis Pathway stri00261   Monobactam biosynthesis stri01100   Metabolic pathways stri01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stri00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     C7M71_026765  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:stri01008]     C7M71_026765 Polyketide biosynthesis proteins [BR:stri01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     C7M71_026765 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AXI80469 UniProt:  A0A345T3B4 LinkDB All DBs Position 6271083..6271298 Genome browser AA seq 71 aa AA seqDB search MTNPFDDQDGTFLVLVNQENQHSLWPQFADVPAGWTVAHGPDTQAACLEYVEQAWTDMRP KSLADAMDAQR NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccccttcgacgaccaggacggcaccttcctcgtgctcgtcaaccaggagaac cagcactcgctgtggccgcagttcgcggacgtccccgccggctggaccgtcgcccacggc cccgatacccaggccgcctgcctggagtacgtcgagcaggcctggaccgatatgcggccc aagagcctcgccgacgccatggacgcccagcggtag

DBGET integrated database retrieval system