Streptomyces sp. Mg1: M444_37885 Help Entry M444_37885        CDS       T03958                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism strm  Streptomyces sp. Mg1 Pathway strm00261   Monobactam biosynthesis strm01100   Metabolic pathways strm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strm00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     M444_37885  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:strm01008]     M444_37885 Polyketide biosynthesis proteins [BR:strm01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     M444_37885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AKL71147 UniProt:  B4VDW0 LinkDB All DBs Position pSMg1-3:84539..84760 Genome browser AA seq 73 aa AA seqDB search MTNPFDSDGADPARKAFLVLVNTIGQHSLWPAHLETPAGWPVALGPARRAECMDFISRRP SPHRLTTALPAAA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacgaacccgttcgacagcgacggcgcggaccccgcgcgcaaggcgttcctcgtgctc gtcaacacgatcggccagcactcgctgtggccggcccacctggagacgcccgccggctgg cccgtcgcgctcggtccggcccggcgcgcggagtgcatggacttcatcagccgccgcccg agcccgcaccgcctcaccaccgcgctgcccgccgccgcctga

DBGET integrated database retrieval system