Streptomyces sp. MOE7: STRMOE7_33600 Help Entry STRMOE7_33600     CDS       T05374                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism stro  Streptomyces sp. MOE7 Pathway stro00261   Monobactam biosynthesis stro01100   Metabolic pathways stro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stro00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     STRMOE7_33600  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:stro01008]     STRMOE7_33600 Polyketide biosynthesis proteins [BR:stro01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     STRMOE7_33600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ARH94413 UniProt:  A0A1W5XX31 LinkDB All DBs Position complement(7665373..7665582) Genome browser AA seq 69 aa AA seqDB search MSASSAPRPAEDRYVVVVNHEEQYSVWFADRALPAGWTATGAQGTRQECLDHIEQVWTDL TPRSVRAPR NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcgcctcatccgccccgcgccccgccgaggaccggtacgtcgtcgtggtgaaccac gaggagcagtactcggtctggttcgccgatcgtgccctgcccgccggctggaccgccacc ggcgcgcagggcacccgccaggagtgcctggaccacatcgagcaggtgtggaccgacctg accccgcgctccgtgcgagcgccgcgatga

DBGET integrated database retrieval system