Streptomyces sp. PAMC 26508: F750_6401 Help Entry F750_6401         CDS       T02619                                  Name (GenBank) mbtH-like protein   KO K05375   MbtH protein Organism strp  Streptomyces sp. PAMC 26508 Pathway strp00261   Monobactam biosynthesis strp01100   Metabolic pathways strp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     F750_6401  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:strp01008]     F750_6401 Polyketide biosynthesis proteins [BR:strp01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     F750_6401 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGJ58826 LinkDB All DBs Position complement(6828849..6829055) Genome browser AA seq 68 aa AA seqDB search MTNPFDDPRTQHRVLVNDEGQHALWPSFASVPAGWDEVFGPADHADCLDYVEVNWTDITP RSARVRVA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgacgaaccccttcgacgacccccgcacccagcaccgcgtcctggtgaacgacgaggga cagcacgcactctggccgtccttcgcctcggtgccggccggctgggacgaggtgttcggc ccggctgaccacgcggactgcctcgattacgtggaggtcaactggaccgacatcaccccg agaagcgcccgtgtacgggtggcctga

DBGET integrated database retrieval system