Streptomyces sp. PAMC 26508: F750_6913 Help Entry F750_6913         CDS       T02619                                  Name (GenBank) putative MbtH family protein   KO K05375   MbtH protein Organism strp  Streptomyces sp. PAMC 26508 Pathway strp00261   Monobactam biosynthesis strp01100   Metabolic pathways strp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     F750_6913  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:strp01008]     F750_6913 Polyketide biosynthesis proteins [BR:strp01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     F750_6913 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF6255 Motif Other DBs NCBI-ProteinID:  AGJ59337 LinkDB All DBs Position 7373296..7373568 Genome browser AA seq 90 aa AA seqDB search MNNPFDAEDGSYLVLANAERQHSLWPAAIDVPAGWSTVFGADTRTACLAHVERNWTDMRP AGLAAAMDEGPQPAAKGTADRGPTSTGTSR NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaatccgttcgacgccgaagacggctcctacctcgtcctggccaacgcggagcgg cagcactccctgtggcccgcggccatcgacgtgcccgccggctggtccaccgtcttcgga gccgacacgcggaccgcgtgcctggcccatgtcgagaggaactggacggacatgcggccg gccggtctcgcggccgcgatggacgagggcccgcagccggccgcgaaagggaccgccgac cgcgggccgacgtccaccgggacgtcgcggtga

DBGET integrated database retrieval system