Streptomonospora litoralis: EKD16_14315 Help Entry EKD16_14315       CDS       T05863                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism strr  Streptomonospora litoralis Pathway strr00261   Monobactam biosynthesis strr01100   Metabolic pathways strr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     EKD16_14315  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:strr01008]     EKD16_14315 Polyketide biosynthesis proteins [BR:strr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     EKD16_14315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  QBI54644 UniProt:  A0A4P6Q6U4 LinkDB All DBs Position complement(3255063..3255275) Genome browser AA seq 70 aa AA seqDB search MSNPFDDPEGRFLVLVNDEDQHSLWPEFAEVPEGWQQVHGPVERAAALEYVEANWTDLRP RSLRVAMGES NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccgttcgacgaccccgaaggccgcttcctggtgctggtcaacgacgaggac cagcactcgctgtggccggagttcgccgaggtgcccgagggctggcagcaggtgcacggg cccgtggagcgcgcggccgcgctggagtacgtcgaggccaactggaccgacctgcgcccg cgcagcctgcgcgtggccatgggcgagtcctga

DBGET integrated database retrieval system