Streptomyces sp. 71268: OYE22_18190 Help Entry OYE22_18190       CDS       T09829                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism strz  Streptomyces sp. 71268 Pathway strz00790   Folate biosynthesis strz01100   Metabolic pathways strz01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:strz00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     OYE22_18190 (folB) Enzymes [BR:strz01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      OYE22_18190 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      OYE22_18190 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      OYE22_18190 (folB) BRITE hierarchy Motif Pfam:  FolB Rv2993c-like_N Motif Other DBs NCBI-ProteinID:  WEV26915 LinkDB All DBs Position 4656655..4657014 Genome browser AA seq 119 aa AA seqDB search MDRVALRGLTARGHHGVFPEERAKGQTFVVDLVLGLDTRPAAADDDLTKTVHYGVVAEEV VAVVAGEPVDLIETLAERIAQKCLEHAAVREVEVVVHKPEAPITVPFDDVTITITRSRV NT seq 360 nt NT seq  +upstreamnt  +downstreamnt gtggatcgtgtcgcgctgcgcggcctgacggcccgtgggcaccacggcgtgttccccgag gagcgcgcgaagggtcagaccttcgtcgtggacctggtgctcggcctggacacgcgtccg gcggcggccgacgacgacctcacgaagaccgtgcactacggggtcgtggccgaggaggtc gtggccgtggtggcgggggagccggtggacctgatcgagacgctcgcggagcggatcgcc cagaagtgcctggagcacgcggcggtgcgcgaggtggaggtcgtcgtgcacaagccggaa gccccgatcaccgttccctttgacgacgtgaccattaccatcacgcggagccgagtatga

DBGET integrated database retrieval system