Streptomyces sp. 71268: OYE22_21900 Help Entry OYE22_21900       CDS       T09829                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism strz  Streptomyces sp. 71268 Pathway strz00261   Monobactam biosynthesis strz01100   Metabolic pathways strz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strz00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     OYE22_21900  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:strz01008]     OYE22_21900 Polyketide biosynthesis proteins [BR:strz01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     OYE22_21900 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WEV27544 LinkDB All DBs Position complement(5542279..5542494) Genome browser AA seq 71 aa AA seqDB search MTNPFDDEGGRYLVLVNAEEQHSLWPASTAVPPGWTVAHAEDSRAACEAYVEEHWSDLRP ASLRRLTEQAG NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgacgaacccgttcgacgacgagggcggccgctacctcgtactcgtcaacgccgaggag cagcactcgctgtggcccgccagcaccgccgtcccgccgggctggacggtggcgcacgcc gaggacagccgcgccgcgtgcgaggcgtacgtcgaggagcactggagcgacctgcgcccg gccagcctgcgccgactgacggagcaggctggctga

DBGET integrated database retrieval system