Streptomyces qaidamensis: A4E84_32745 Help Entry A4E84_32745       CDS       T04777                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism stsi  Streptomyces qaidamensis Pathway stsi00261   Monobactam biosynthesis stsi01100   Metabolic pathways stsi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stsi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     A4E84_32745  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:stsi01008]     A4E84_32745 Polyketide biosynthesis proteins [BR:stsi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     A4E84_32745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  AMW13853 UniProt:  A0A143C8T4 LinkDB All DBs Position 7436979..7437203 Genome browser AA seq 74 aa AA seqDB search MSTNPFEDPDGTYLVLVNDEGQHSLWPAFVEVPAGWQVALKETDRQSALDYVNEHWTDMR PKSLIEAMEKAGAA NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaacccgttcgaggaccccgacggcacctacctggtcctcgtcaacgacgaa ggccagcactcgctgtggcccgcgttcgtcgaggtaccggcgggctggcaggtcgcgctc aaggagacggaccggcagtcggcgctcgactacgtcaacgagcactggaccgacatgcgg cccaagagcctcatcgaggccatggagaaggccggcgccgcctga

DBGET integrated database retrieval system