Streptomyces tsukubensis: B7R87_00950 Help Entry B7R87_00950       CDS       T07155                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism stsu  Streptomyces tsukubensis Pathway stsu00261   Monobactam biosynthesis stsu01100   Metabolic pathways stsu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stsu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     B7R87_00950  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:stsu01008]     B7R87_00950 Polyketide biosynthesis proteins [BR:stsu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     B7R87_00950 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AZK92622 LinkDB All DBs Position 368941..369156 Genome browser AA seq 71 aa AA seqDB search MPNPFEDPDASYLVLVNDEGQHSLWPVFVDVPDGWRTVFGEAPRTECLEYIEKSWTDMRP KSLIEAMNGSK NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgccgaacccctttgaggatcccgacgcaagctatctggttctggtcaacgacgagggt cagcattcgctctggccggtcttcgtggatgtgcccgacggctggagaaccgtcttcggc gaggcaccccggacggagtgcctggagtacatcgagaagtcgtggaccgatatgcggccc aagagcctgatcgaagccatgaacggcagtaagtag

DBGET integrated database retrieval system