Streptomyces sp. TN58: BSL84_27600 Help Entry BSL84_27600       CDS       T09761                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sttn  Streptomyces sp. TN58 Pathway sttn00261   Monobactam biosynthesis sttn01100   Metabolic pathways sttn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sttn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BSL84_27600  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sttn01008]     BSL84_27600 Polyketide biosynthesis proteins [BR:sttn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BSL84_27600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  APU42985 UniProt:  A0A1L7GM09 LinkDB All DBs Position complement(6111518..6111730) Genome browser AA seq 70 aa AA seqDB search MTNPFEDDATAYVVLTNTENQHSLWPATADVPKGWTVRHEGSRQSCLDYVETHWTDLRPA SLASRMGKPA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccccttcgaagacgacgccaccgcctacgtcgtgcttaccaacaccgagaac cagcactcgctctggcccgccacagctgacgtgccgaagggatggaccgtaaggcacgag gggtcacgacagagctgcctcgactacgtcgagacgcactggacagaccttcgccccgcc agtctcgcctccagaatgggcaagcctgcctag

DBGET integrated database retrieval system