Streptomyces sp. TN58: BSL84_31170 Help Entry BSL84_31170       CDS       T09761                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sttn  Streptomyces sp. TN58 Pathway sttn00261   Monobactam biosynthesis sttn01100   Metabolic pathways sttn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sttn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BSL84_31170  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sttn01008]     BSL84_31170 Polyketide biosynthesis proteins [BR:sttn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BSL84_31170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  APU43543 UniProt:  A0A1L7GND6 LinkDB All DBs Position 6901316..6901528 Genome browser AA seq 70 aa AA seqDB search MSTNPFDDDEGRFLVLVNDEGQHSLWPSFADVPGGWTIALGENTRAACLDFVEANWTDLR PRSLARTADA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt gtgagcaccaaccccttcgacgacgacgagggccgcttcctcgtcctggtgaacgacgag ggccagcactcgctctggccgtccttcgccgacgtgcccggcggatggacgatcgccctg ggcgagaacacccgggcggcgtgcctggacttcgtcgaggcgaactggaccgatctgcgg ccccggtccctcgcccggacggcggacgcctga

DBGET integrated database retrieval system