Streptomyces tubercidicus: STRTU_000726 Help Entry STRTU_000726      CDS       T09099                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism stud  Streptomyces tubercidicus Pathway stud00261   Monobactam biosynthesis stud01100   Metabolic pathways stud01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stud00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     STRTU_000726  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:stud01008]     STRTU_000726 Polyketide biosynthesis proteins [BR:stud01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     STRTU_000726 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WAU10626 LinkDB All DBs Position complement(811364..811576) Genome browser AA seq 70 aa AA seqDB search MTNPFENPDGTYSVLVNDENQHSLWPDTVDVPAGWTVAHPSDTRETCLRFIEENWTDMRP RSLAQRMADN NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgacgaaccccttcgagaacccggacggcacgtactcggtgctcgtcaacgacgagaac cagcactcgctctggccggacaccgtggacgtgcccgcgggctggaccgtcgcgcacccg agcgacacccgcgagacctgcctgcgcttcatcgaggagaactggaccgacatgcgcccg cgcagcctcgcgcagcgcatggcggacaactga

DBGET integrated database retrieval system