Candidatus Sulfuricurvum sp. RIFRC-1: B649_06100 Help Entry B649_06100        CDS       T02537                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism sulr  Candidatus Sulfuricurvum sp. RIFRC-1 Pathway sulr00020   Citrate cycle (TCA cycle) sulr00720   Carbon fixation pathways in prokaryotes sulr01100   Metabolic pathways sulr01110   Biosynthesis of secondary metabolites sulr01120   Microbial metabolism in diverse environments sulr01200   Carbon metabolism sulr01210   2-Oxocarboxylic acid metabolism Module sulr_M00009   Citrate cycle (TCA cycle, Krebs cycle) sulr_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate sulr_M00173   Reductive citrate cycle (Arnon-Buchanan cycle) Brite KEGG Orthology (KO) [BR:sulr00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     B649_06100   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     B649_06100 Enzymes [BR:sulr01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      B649_06100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_6 Fer4_21 Fer4_2 Fer4_10 Fer4_9 Fer4_4 Fer4_16 Fer4_13 Fer4_17 Fer4_8 Fer4_3 Furin-like_2 Fer4_15 ETF_QO Fer4_22 Motif Other DBs NCBI-ProteinID:  AFV97534 UniProt:  K7T111 LinkDB All DBs Position complement(1230439..1230768) Genome browser AA seq 109 aa AA seqDB search MFKTINPGNVPVWVNTDNCKACDICVSVCPSGVLGMRYEPTSTLGAMISINHPESCIGCN ECELTCPDFAIYVADKADYKFAKLTDEAKVRQAAIIANKYMSLDQAGVK NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgtttaaaacgatcaatcccggtaacgtccctgtatgggtaaataccgataactgtaaa gcatgtgatatttgtgtatcggtatgcccatcgggtgtactcggtatgcgttatgagccg acatcaaccttgggcgctatgatctcgatcaatcaccctgaaagttgcatcggctgtaac gagtgtgaactcacatgtcctgactttgctatttatgttgcagataaagcagattacaaa tttgcaaaacttactgatgaagcaaaagtacgtcaagcggctattatcgctaataagtat atgtcactagaccaagcaggagtgaagtaa

DBGET integrated database retrieval system