Sceloporus undulatus (fence lizard): 121931738 Help Entry 121931738         CDS       T07740                                  Name (RefSeq) ferritin, higher subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism sund  Sceloporus undulatus (fence lizard) Pathway sund00860   Porphyrin metabolism sund04216   Ferroptosis sund04217   Necroptosis Brite KEGG Orthology (KO) [BR:sund00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     121931738  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     121931738    04217 Necroptosis     121931738  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sund04147]     121931738 Enzymes [BR:sund01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      121931738 Exosome [BR:sund04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    121931738   Exosomal proteins of bladder cancer cells    121931738 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin Uds1 AP_endonuc_2 Exo84_C Motif Other DBs NCBI-GeneID:  121931738 NCBI-ProteinID:  XP_042325653 LinkDB All DBs Position 5:184495307..184558659 Genome browser AA seq 124 aa AA seqDB search MLAAAKLSSRRAARVTATAANTSAAVFAGLRKPEKDEWGNTLDALQRALALEKEVNQALL NLHKLATDKRDPHLCDFLESEYLEEQVKAIKQLGDHLTNLKRLGLPQNGMGEYLFERLTA GKSS NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgcttgctgcggccaagttgagctcgcgcagagccgctcgcgtgactgccactgcggcc aacaccagcgccgcagtctttgctggcctgcggaaaccagagaaagatgagtggggtaac accttggatgcccttcagagggccttggcactggagaaggaggtcaaccaggccctgctg aatctgcacaagctggccactgacaaaagagaccctcacctgtgtgacttcttggagtct gaatacctggaggaacaagtgaaggccattaagcaactgggagaccacctcacaaacctg aagcgtttgggcctgccccagaatggaatgggggaatacttgtttgaaaggctcacagca ggaaaaagcagctga

DBGET integrated database retrieval system