Stigmatella aurantiaca: STAUR_4844 Help Entry STAUR_4844        CDS       T01425                                  Name (GenBank) MbtH-like domain protein   KO K05375   MbtH protein Organism sur  Stigmatella aurantiaca Pathway sur00261   Monobactam biosynthesis sur01100   Metabolic pathways sur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sur00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     STAUR_4844  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sur01008]     STAUR_4844 Polyketide biosynthesis proteins [BR:sur01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     STAUR_4844 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ADO72622 UniProt:  Q091C9 LinkDB All DBs Position complement(5946118..5946342) Genome browser AA seq 74 aa AA seqDB search MATNEQEDTAIYKVVMNHEEQYSIWPADRENALGWKDAGKQGAKAECLEYIKQVWTDMRP LSLRKKMEAQTSRN NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggctacgaatgagcaagaggacacggcaatctacaaggtggtgatgaaccacgaggag cagtactccatctggcctgcggatcgcgagaacgcactgggctggaaggatgctggcaag cagggcgccaaggccgagtgcctggagtacatcaagcaggtctggacggacatgcgtcct ctgagcctgcgcaagaagatggaagcgcagacttcgcgcaactga

DBGET integrated database retrieval system